General Information

  • ID:  hor003007
  • Uniprot ID:  P55206
  • Protein name:  CNP-22
  • Gene name:  NPPC
  • Organism:  Bos taurus (Bovine)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0051427 hormone receptor binding
  • GO BP:  GO:0001503 ossification; GO:0001525 angiogenesis; GO:0001541 ovarian follicle development; GO:0001549 cumulus cell differentiation; GO:0001974 blood vessel remodeling; GO:0002931 response to ischemia; GO:0003418 growth plate cartilage chondrocyte differentiation; GO:0003419 growth plate cartilage chondrocyte proliferation; GO:0006182 cGMP biosynthetic process; GO:0006457 protein folding; GO:0006874 intracellular calcium ion homeostasis; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0009611 response to wounding; GO:0009791 post-embryonic development; GO:0022414 reproductive process; GO:0035483 gastric emptying; GO:0036293 response to decreased oxygen levels; GO:0040014 regulation of multicellular organism growth; GO:0043524 negative regulation of neuron apoptotic process; GO:0048513 animal organ development; GO:0048599 oocyte development; GO:0048678 response to axon injury; GO:0051276 chromosome organization; GO:0051321 meiotic cell cycle; GO:0051447 negative regulation of meiotic cell cycle; GO:0061939 c-di-GMP signaling; GO:0071965 multicellular organismal locomotion; GO:0090649 response to oxygen-glucose deprivation; GO:0097746 blood vessel diameter maintenance; GO:1900194 negative regulation of oocyte maturation; GO:1903537 meiotic cell cycle process involved in oocyte maturation; GO:1904588 cellular response to glycoprotein
  • GO CC:  GO:0005576 extracellular region; GO:0032991 protein-containing complex

Sequence Information

  • Sequence:  GLSKGCFGLKLDRIGSMSGLGC
  • Length:  22(105-126)
  • Propeptide:  MHLSQLLACALLLALLSLRPSEAKPGAPPKVPRTPSGEEVAEPQAAGGGQKKGDKTPGGGGANLKDDRSRLLRDLRVDTKSRAAWTRLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSMSGLGC
  • Signal peptide:  MHLSQLLACALLLALLSLRPSEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation. May also be vasoactive and natriuretic.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NPR2, NPR3
  • Target Unid:  P46197, P10730
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 4.3 minutes; /258 seconds ( PubMed ID: 21459096 )

Structure

  • Disulfide bond:  45830
  • Structure ID:  AF-Q9SI57-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9SI57-F1.pdbhor003007_AF2.pdbhor003007_ESM.pdb

Physical Information

Mass: 257440 Formula: C93H159N27O28S3
Absent amino acids: AEHNPQTVWY Common amino acids: G
pI: 8.82 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 6
Hydrophobicity: 40 Boman Index: -681
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 88.64
Instability Index: 1451.36 Extinction Coefficient cystines: 125
Absorbance 280nm: 5.95

Literature